PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011558
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 503aa    MW: 54756.9 Da    PI: 8.7501
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011558genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.23.3e-24175219145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCsr++ +++k+CErH+++gr+rsrk++e 
  Lus10011558 175 DPEPGRCRRTDGKKWRCSRDAFADQKYCERHISKGRHRSRKPVEG 219
                  79****************************************985 PP

2QLQ58.12.7e-20100136137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  ++FT++Q+++L++Q+l+yKy+ an+ vP++Ll +i+k
  Lus10011558 100 GPFTPSQWMELEHQALIYKYITANVAVPSNLLNPIKK 136
                  59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-11100136IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.983101136IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-14101134IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.072175219IPR014977WRC domain
PfamPF088791.9E-20176218IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MDFGVLGLDV GHPPLPPPQL EIASSAAAQD VVWMKPSKIQ RTSDDEQQQD VDFSPPNRTI  60
LRSNSTPSTH FSSGNQSYYP PPAPPPPGSS LNVTMHGVRG PFTPSQWMEL EHQALIYKYI  120
TANVAVPSNL LNPIKKSIYP FALSSNNTIS SAASFIPSHL GWGAFHLGYP GSANDPEPGR  180
CRRTDGKKWR CSRDAFADQK YCERHISKGR HRSRKPVEGT KVVSTNSNSN AAAAAGANVR  240
AASNCISITQ QQLKYMQQLT AHRNSSPDAF PNRFTLTDVN ANTNGRFQVP RAPKQNVAIK  300
ESPYSEFGHV SFDSSLNPSQ HKNTSGSCSY NSFLNFNGQD HTQDQHSLHQ FMDNDWPKDH  360
QSSRNVISWP EDQLKSDWTQ LSMSIPMTSS PPHEKLALSP LRLSRELDTK PTASWMPIAW  420
GSASMGGGPL GEALSGNVNK SMVTEELGFS PTGVLQKATF GSLSNNSSSG SSPRGGDESK  480
RNHLCEDLIG SRIASSIAVP YL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818752e-36LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132622e-36LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320668.11e-121hypothetical protein POPTR_0014s00780g
SwissprotO810011e-83GRF1_ARATH; Growth-regulating factor 1
TrEMBLB9IBM41e-121B9IBM4_POPTR; Uncharacterized protein
STRINGPOPTR_0014s00780.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.14e-81growth-regulating factor 1